PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g012500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MYB
Protein Properties Length: 625aa    MW: 68781.5 Da    PI: 5.4864
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g012500.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-164289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+++ ++  + R++k+c++rw ++l
   Csa01g012500.1 42 KGPWTSTEDGILIDYVKKHGEGNWNAVQKHTSLARCGKSCRLRWANHL 89
                     79******************************************9986 PP

2Myb_DNA-binding49.87.7e-1695138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ +++ G++ W+  a++++ gRt++++k++w++
   Csa01g012500.1  95 KGAFSEEEEQLIVEMHAKIGNK-WAQMAEHLP-GRTDNEIKNYWNT 138
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6843789IPR017930Myb domain
SuperFamilySSF466894.49E-2940136IPR009057Homeodomain-like
SMARTSM007171.4E-114191IPR001005SANT/Myb domain
PfamPF002496.4E-144289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-234396IPR009057Homeodomain-like
CDDcd001679.27E-104489No hitNo description
PROSITE profilePS5129425.30790144IPR017930Myb domain
SMARTSM007174.7E-1694142IPR001005SANT/Myb domain
PfamPF002497.9E-1595138IPR001005SANT/Myb domain
CDDcd001671.71E-1197138No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2497143IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MSYLTTVESD DGMHSSIYNE SSAADSISNG YRSRGRGGAL KKGPWTSTED GILIDYVKKH  60
GEGNWNAVQK HTSLARCGKS CRLRWANHLR PNLKKGAFSE EEEQLIVEMH AKIGNKWAQM  120
AEHLPGRTDN EIKNYWNTRI KRRQRAGLPL YPPEIHVEDL QWSEEDTKSN IIRVDRRRRQ  180
DFLQLGNSKA NLLFDDLSFA ASLLPAASDL SDLVACNMLG TGASSSWYES YMPPILPSPK  240
QLWDSGSRFP MCSSNIKHEV QSPEYFQDTA SQKNPRSXSL LPAGSDLSDL VACNMLGTGA  300
SSSWYESYMP PILPSPKQLW DSGSRFPMCS SNIKHEVQSP EYFQNTASQK NPRSCSISPC  360
YVDHPPYGNQ HSSDMMMILD SHTLADGMLP TSKPSFGAVK LELPSFQYSE TSAFDQWKAT  420
PSPPHSDLLD SVDAYIQSPP PSEIEESDCF SSCDTGLLDM LLHEAKIKTS AKHSLLSSSP  480
EKSFSSTTCT TDATQNVPRS QIKPGELENF QMNLTRSEIS IPSQLSAGGI SSGNFVKTEE  540
VDQVWEPKRV DMTRPDVLLA SSWLDQGCYG IVRDTSSMSD ALALLLGGDD TGNSYVTVGS  600
SSGQAPRGGV GSCGWTNMPP VWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32401435107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195850.0AY519585.1 Arabidopsis thaliana MYB transcription factor (At3g11440) mRNA, complete cds.
GenBankBT0039400.0BT003940.1 Arabidopsis thaliana clone RAFL15-06-P04 (R20731) putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
GenBankBT0051200.0BT005120.1 Arabidopsis thaliana clone U20731 putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010495790.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLR0G4540.0R0G454_9BRAS; Transcription factor
STRINGfgenesh2_kg.3__1182__AT3G11440.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65